PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000224540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 193aa    MW: 21173 Da    PI: 9.3818
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000224540genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.35.8e-20121155135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C++Cg+ +Tp+WR gp g+ktLCnaCG++y++ +l
  MDP0000224540 121 CQHCGADETPQWRAGPLGPKTLCNACGVRYKSGRL 155
                    *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.5E-16115165IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.662115151IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-15118153IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.62E-15118178No hitNo description
CDDcd002022.62E-14120168No hitNo description
PROSITE patternPS003440121146IPR000679Zinc finger, GATA-type
PfamPF003201.1E-17121155IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
EEGVEEELEW LSNKDAFPAV ETFVDINLLI GQPAGIGTDK HQSPVSVLDN GTTPTTTLMS  60
SCGTLKPPQG ARSKGRRRRE SSSFPGTLEE HVFWSQSNNC KKDDKTIVKR TTGMAMIGRV  120
CQHCGADETP QWRAGPLGPK TLCNACGVRY KSGRLVPEYR PASSPTFSSK LHSNSHRKIM  180
EMRKQKHGTG MSA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368588.11e-133PREDICTED: GATA transcription factor 1-like
SwissprotQ8LAU92e-49GATA1_ARATH; GATA transcription factor 1
TrEMBLA0A061ESZ53e-65A0A061ESZ5_THECC; GATA transcription factor 1, putative
STRINGGLYMA10G25480.12e-60(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85372941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.15e-47GATA transcription factor 1